Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CHRNA1 protein

This Mouse CHRNA1 protein spans the amino acid sequence from region 21-230aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chrna1, Acra, Acetylcholine receptor subunit alpha

UniProt

P04756

Expression Region

21-230aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 21-230aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hoxd8 (NM_008276) Mouse Tagged ORF Clone Lentiviral Particle
MR220999L4V 200 µL

Hoxd8 (NM_008276) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MCM3 (E-8) Alexa Fluor® 790
sc-390480 AF790 200 µg/mL

MCM3 (E-8) Alexa Fluor® 790

Sign In for Pricing
View Details
DGKZ (Diacylglycerol Kinase zeta, DAG Kinase zeta, Diglyceride Kinase zeta, DGK-zeta, DAGK6) (HRP)
MBS6376099-01 0.1 mL

DGKZ (Diacylglycerol Kinase zeta, DAG Kinase zeta, Diglyceride Kinase zeta, DGK-zeta, DAGK6) (HRP)

Sign In for Pricing
View Details
DGKZ (Diacylglycerol Kinase zeta, DAG Kinase zeta, Diglyceride Kinase zeta, DGK-zeta, DAGK6) (HRP)
MBS6376099-02 5x 0.1 mL

DGKZ (Diacylglycerol Kinase zeta, DAG Kinase zeta, Diglyceride Kinase zeta, DGK-zeta, DAGK6) (HRP)

Sign In for Pricing
View Details
Defensin alpha 1 Antibody
MBS8581989-01 0.1 mL

Defensin alpha 1 Antibody

Sign In for Pricing
View Details
Defensin alpha 1 Antibody
MBS8581989-02 0.1 mL (AF635)

Defensin alpha 1 Antibody

Sign In for Pricing
View Details