Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CHRNA1 protein

This Mouse CHRNA1 protein spans the amino acid sequence from region 21-230aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chrna1, Acra, Acetylcholine receptor subunit alpha

UniProt

P04756

Expression Region

21-230aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 21-230aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC111 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0383506 1.0 µg DNA

CCDC111 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
DPP6 3'UTR Lenti-reporter-Luc Vector
18544081 1.0 µg

DPP6 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Serum Amyloid P Component (APCS) Antibody
abx102486-01 100 µL

Serum Amyloid P Component (APCS) Antibody

Sign In for Pricing
View Details
Serum Amyloid P Component (APCS) Antibody
abx102486-02 200 µL

Serum Amyloid P Component (APCS) Antibody

Sign In for Pricing
View Details
Serum Amyloid P Component (APCS) Antibody
abx102486-03 1 mL

Serum Amyloid P Component (APCS) Antibody

Sign In for Pricing
View Details
Interleukin 8 Receptor Alpha (IL8Ra) Antibody (APC)
abx177206-01 200 µg

Interleukin 8 Receptor Alpha (IL8Ra) Antibody (APC)

Sign In for Pricing
View Details