Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CHRNA1 protein

This Mouse CHRNA1 protein spans the amino acid sequence from region 21-230aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chrna1, Acra, Acetylcholine receptor subunit alpha

UniProt

P04756

Expression Region

21-230aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 21-230aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MATN1, Control Peptide (Cartilage Matrix Protein, Matrilin-1, CMP, CRTM)
149207 50 µg

MATN1, Control Peptide (Cartilage Matrix Protein, Matrilin-1, CMP, CRTM)

Sign In for Pricing
View Details
NFU1 Polyclonal Antibody
RD84283A-01 60μL

NFU1 Polyclonal Antibody

Sign In for Pricing
View Details
NFU1 Polyclonal Antibody
RD84283A-02 120μL

NFU1 Polyclonal Antibody

Sign In for Pricing
View Details
NFU1 Polyclonal Antibody
RD84283A-03 200μL

NFU1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O1:K1/APEC MSRQ Polyclonal Antibody
MBS7166963 Inquire

Rabbit anti-Escherichia coli O1:K1/APEC MSRQ Polyclonal Antibody

Sign In for Pricing
View Details
CCR2 Rabbit Polyclonal Antibody (FITC)
orb2100120 100 µL

CCR2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details