Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat CA1 protein

This Rat CA1 protein spans the amino acid sequence from region 2-261aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carbonate dehydratase I

UniProt

B0BNN3

Expression Region

2-261aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 2-261aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Noggin/NOG Protein, Human, Recombinant (hFc)
TMPY-00890-01 500 µg

Noggin/NOG Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
Noggin/NOG Protein, Human, Recombinant (hFc)
TMPY-00890-02 5 µg

Noggin/NOG Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
Noggin/NOG Protein, Human, Recombinant (hFc)
TMPY-00890-03 10 µg

Noggin/NOG Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
Noggin/NOG Protein, Human, Recombinant (hFc)
TMPY-00890-04 20 µg

Noggin/NOG Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
Noggin/NOG Protein, Human, Recombinant (hFc)
TMPY-00890-05 50 µg

Noggin/NOG Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
Noggin/NOG Protein, Human, Recombinant (hFc)
TMPY-00890-06 100 µg

Noggin/NOG Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details