Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat CA1 protein

This Rat CA1 protein spans the amino acid sequence from region 2-261aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carbonate dehydratase I

UniProt

B0BNN3

Expression Region

2-261aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 2-261aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM34 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
38629124 3x 1.0µg DNA

RBM34 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Mouse TRP-1 & OX40 Bispecific Antibody
E55A15861 100 µg

Mouse TRP-1 & OX40 Bispecific Antibody

Sign In for Pricing
View Details
Cat Wingless Type MMTV Integration Site Family, Member 2 ELISA Kit
MBS100758 Inquire

Cat Wingless Type MMTV Integration Site Family, Member 2 ELISA Kit

Sign In for Pricing
View Details
Recombinant Rabbit Prolactin
7-01428 1 mg

Recombinant Rabbit Prolactin

Sign In for Pricing
View Details
Polyclonal OXER1 Antibody (C-Terminus)
APR17694G 0.05mg

Polyclonal OXER1 Antibody (C-Terminus)

Sign In for Pricing
View Details
ST6GALNAC5 Human Over-expression Lysate
orb1351272 100 µg

ST6GALNAC5 Human Over-expression Lysate

Sign In for Pricing
View Details