Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BRCC3 protein

This Human BRCC3 protein spans the amino acid sequence from region 2-316aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BR, CA1-A complex subunit BR, CC36BR, CA1/BR, CA2-containing complex subunit 3BR, CA1/BR, CA2-containing complex subunit 36BRISC complex subunit BR, CC36

UniProt

P46736

Expression Region

2-316aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-GST-tagged Expression Region: 2-316aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ccdc162 shRNA (UAS) - Lentiviral mouse Ccdc162 shRNA (UAS, RFP) (25)
GTR15138983 1 Vial

Lentiviral mouse Ccdc162 shRNA (UAS) - Lentiviral mouse Ccdc162 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Phospho-RPS6KA1 (Thr359 + Ser363) Polyclonal Antibody, PE Conjugated
bs-3363R-PE 100 µL

Phospho-RPS6KA1 (Thr359 + Ser363) Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Rabbit Anti Human SGK1 Monoclonal Clone EHF-19 100ug
IRBAHUSGK1EHF19C100ug 100 µg

Rabbit Anti Human SGK1 Monoclonal Clone EHF-19 100ug

Sign In for Pricing
View Details
SLC38A3 Adenovirus (Human)
44170051 1.0 mL

SLC38A3 Adenovirus (Human)

Sign In for Pricing
View Details
TXNRD1-set siRNA/shRNA/RNAi Lentivector (Human)
48884091 4x 500 ng

TXNRD1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Sprr2i sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3170207 1.0 µg DNA

Sprr2i sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details