What is the catalog number for Bacterial hlb protein?

The catalog number for Bacterial hlb protein is orb418697.

What sizes are available for Bacterial hlb protein?

Bacterial hlb protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Bacterial hlb protein come in?

Bacterial hlb protein is available in 3 different pack sizes.

Is Bacterial hlb protein in stock?

Bacterial hlb protein is currently made to order / not held in immediate stock. Contact us for lead time.

Bacterial hlb protein

This Bacterial hlb protein spans the amino acid sequence from region 35-330aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-hemolysin Beta-toxin Sphingomyelinase plc

UniProt

P09978

Expression Region

35-330aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Staphylococcus aureus (strain MRSA252)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 35-330aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESKKDDTDLKLVSHNVYMLSTVLYPNWGQYKRADLIGQSSYIKNNDVVIFNEAFDNGASDKLLSNVKKEYPYQTPVLGRSQSGWDKTEGSYSSTVAEDGGVAIVSKYPIKEKIQHVFKSGCGFDNDSNKGFVYTKIEKNGKNVHVIGTHTQSEDSRCGAGHDRKIRAEQMKEISDFVKKKNIPKDETVYIGGDLNVNKGTPEFKDMLKNLNVNDVLYAGHNSTWDPQSNSIAKYNYPNGKPEHLDYIFTDKDHKQPKQLVNEVVTEKPKPWDVYAFPYYYVYNDFSDHYPIKAYSK