Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial hlb protein

This Bacterial hlb protein spans the amino acid sequence from region 35-330aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-hemolysin Beta-toxin Sphingomyelinase plc

UniProt

P09978

Expression Region

35-330aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Staphylococcus aureus (strain MRSA252)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 35-330aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESKKDDTDLKLVSHNVYMLSTVLYPNWGQYKRADLIGQSSYIKNNDVVIFNEAFDNGASDKLLSNVKKEYPYQTPVLGRSQSGWDKTEGSYSSTVAEDGGVAIVSKYPIKEKIQHVFKSGCGFDNDSNKGFVYTKIEKNGKNVHVIGTHTQSEDSRCGAGHDRKIRAEQMKEISDFVKKKNIPKDETVYIGGDLNVNKGTPEFKDMLKNLNVNDVLYAGHNSTWDPQSNSIAKYNYPNGKPEHLDYIFTDKDHKQPKQLVNEVVTEKPKPWDVYAFPYYYVYNDFSDHYPIKAYSK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

T-type Ca++ CP α1G Double Nickase Plasmid (h2)
sc-418331-NIC-2 20 µg

T-type Ca++ CP α1G Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Nrd1 (NM_146150) Mouse Tagged Lenti ORF Clone
MR211727L3 10 µg

Nrd1 (NM_146150) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ZN277 Antibody
C47295-01 50 µL

ZN277 Antibody

Sign In for Pricing
View Details
ZN277 Antibody
C47295-02 100 µL

ZN277 Antibody

Sign In for Pricing
View Details
Kat5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
25297114 3x 1.0 µg

Kat5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
2- (4-nitro-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl) propanoic acid
sc-320921 100 mg

2- (4-nitro-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl) propanoic acid

Sign In for Pricing
View Details