Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ENGASE protein

This Human ENGASE protein spans the amino acid sequence from region 1-377aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytosolic endo-beta-N-acetylglucosaminidase, DKFZp434P174, ENASE_HUMAN, ENGase, FLJ21865, Mannosyl glycoprotein endo beta N acetylglucosaminidase

UniProt

Q8NFI3

Expression Region

1-377aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-377aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEAAAVTVTRSATRRRRRQLQGLAAPEAGTQEEQEDQEPRPRRRRPGRSIKDEEEETVFREVVSFSPDPLPVRYYDKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLSSQRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTAHRHGVCVLGTFITEWNEGGRLCEAFLAGDERSYQAVADRLVQITQFFRFDGWLINIENSLSLAAVGNMPPFLRYLTTQLHRQVPGGLVLWYDSVVQSGQLKWQDELNQHNRVFFDSCDGFFTNYNWREEHLERMLGQAGERRADVYVGVDVFARGNVVGGRFDTDKSLELIRKHGFSVALFAPSCSVFPGVGNLLCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pax6 Antibody
F53058-0.08ML 0.08 mL

Pax6 Antibody

Sign In for Pricing
View Details
CTNND1 (Catenin Delta-1, Catenin (Cadherin-Associated Protein), Delta 1)
478758 100 µL

CTNND1 (Catenin Delta-1, Catenin (Cadherin-Associated Protein), Delta 1)

Sign In for Pricing
View Details
Anti-EV71 Capsid protein VP1/2/3 Antibody (SAA2027)
VK633033-01 50 µg

Anti-EV71 Capsid protein VP1/2/3 Antibody (SAA2027)

Sign In for Pricing
View Details
Anti-EV71 Capsid protein VP1/2/3 Antibody (SAA2027)
VK633033-02 100 µg

Anti-EV71 Capsid protein VP1/2/3 Antibody (SAA2027)

Sign In for Pricing
View Details
Anti-EV71 Capsid protein VP1/2/3 Antibody (SAA2027)
VK633033-03 1 mg

Anti-EV71 Capsid protein VP1/2/3 Antibody (SAA2027)

Sign In for Pricing
View Details
Chst3 Rat Pre-designed siRNA Set A
HY-RS24864 1 Set

Chst3 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details