Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SPRED1 protein

This Human SPRED1 protein spans the amino acid sequence from region 2-444aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EVH1 domain-containing protein 1, EVH1/Sprouty domain containing protein, FLJ33903, hSpred 1, hSpred1, NFLS, PPP1R147, protein phosphatase 1 regulatory subunit 147, SPRE1_HUMAN, SPRED 1, Spred-1, spred1, Sprouty related EVH1 domain containing 1, sprouty related EVH1 domain containing protein 1, Sprouty related protein 1 with EVH 1 domain, Sprouty-related, Suppressor of Ras/MAPK activation

UniProt

Q7Z699

Expression Region

2-444aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

70.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 2-444aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISQGCPESKNEAEGADDLQANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQPGLDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDETKLSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRGKCQDAPDPIKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCYVPLRMCHRCGEACGCCGGKHKAAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA-PKCS (phospho Ser2612) Rabbit Polyclonal Antibody
E28PP0986 100 µL

DNA-PKCS (phospho Ser2612) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TARSL2 siRNA (Human)
CRJ4731-01 15 nmol

TARSL2 siRNA (Human)

Sign In for Pricing
View Details
TARSL2 siRNA (Human)
CRJ4731-02 30 nmol

TARSL2 siRNA (Human)

Sign In for Pricing
View Details
Human UDP Glucuronosyltransferase 2 Family, Polypeptide B7 (UGT2B7) ELISA Kit
MBS2019182-01 24 Strip Well

Human UDP Glucuronosyltransferase 2 Family, Polypeptide B7 (UGT2B7) ELISA Kit

Sign In for Pricing
View Details
Human UDP Glucuronosyltransferase 2 Family, Polypeptide B7 (UGT2B7) ELISA Kit
MBS2019182-02 48 Strip Well

Human UDP Glucuronosyltransferase 2 Family, Polypeptide B7 (UGT2B7) ELISA Kit

Sign In for Pricing
View Details
Human UDP Glucuronosyltransferase 2 Family, Polypeptide B7 (UGT2B7) ELISA Kit
MBS2019182-03 96 Strip Well

Human UDP Glucuronosyltransferase 2 Family, Polypeptide B7 (UGT2B7) ELISA Kit

Sign In for Pricing
View Details