Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pig IL4R protein

This Pig IL4R protein spans the amino acid sequence from region 33-240aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD_antigen, CD124

UniProt

Q863Z5

Expression Region

33-240aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 33-240aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human/Mouse Integrin β7 Antibody[FIB21]
AN00423D-01 20 Tests

PE Anti-Human/Mouse Integrin β7 Antibody[FIB21]

Sign In for Pricing
View Details
PE Anti-Human/Mouse Integrin β7 Antibody[FIB21]
AN00423D-02 100 Tests

PE Anti-Human/Mouse Integrin β7 Antibody[FIB21]

Sign In for Pricing
View Details
PE Anti-Human/Mouse Integrin β7 Antibody[FIB21]
AN00423D-03 2x 100 Tests

PE Anti-Human/Mouse Integrin β7 Antibody[FIB21]

Sign In for Pricing
View Details
Dpm3 (NM_026767) Mouse Tagged ORF Clone
MG200240 10 µg

Dpm3 (NM_026767) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant CD1C Antibody
RC-16320-01 50 μL

Recombinant CD1C Antibody

Sign In for Pricing
View Details
Recombinant CD1C Antibody
RC-16320-02 100 µL

Recombinant CD1C Antibody

Sign In for Pricing
View Details