Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse VWF protein

This Mouse VWF protein spans the amino acid sequence from region 1498-1665aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Von Willebrand antigen II

UniProt

Q8CIZ8

Expression Region

1498-1665aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1498-1665aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DVVFVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDATRISVLQYSYTVTMEYAFNGAQSKEEVLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDRVEAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPHANMQELERISRPIAPIFIRDFETLPREAPDLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-921 inhibitor
HY-RI02508-01 5 nmol

Hsa-miR-921 inhibitor

Sign In for Pricing
View Details
Hsa-miR-921 inhibitor
HY-RI02508-02 20 nmol

Hsa-miR-921 inhibitor

Sign In for Pricing
View Details
PCDNA3.1-SNAP29 (human) -Linker-EGFP-SV40-Neo
BZ34537 1 Vial

PCDNA3.1-SNAP29 (human) -Linker-EGFP-SV40-Neo

Sign In for Pricing
View Details
Synaptotagmin (Phospho-Thr202) Polyclonal Conjugated Antibody
orb1630874 100 µL

Synaptotagmin (Phospho-Thr202) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Chemokine C-C-Motif Receptor 7
545868 200 µL

Chemokine C-C-Motif Receptor 7

Sign In for Pricing
View Details
Lentiviral mouse Gm12888 shRNA (UAS) - Lentiviral mouse Gm12888 shRNA (UAS, RFP) (25)
GTR15293258 1 Vial

Lentiviral mouse Gm12888 shRNA (UAS) - Lentiviral mouse Gm12888 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details