Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Sult1b1 protein

This Rat Sult1b1 protein spans the amino acid sequence from region 1-299aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DOPA/tyrosine sulfotransferase

UniProt

P52847

Expression Region

1-299aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-299aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGTAEDVFRKDLKIIHGYPMVYAFALGWEKIEEFQSRPCDIVIPTYPKSGTTWLSEIVDMVLNDGNVEKCKRDVITSKVPMLEQNVPGARRSGVELLKKTPSPRIIKTHLPIDLLPKSFWDNKCKMIYLARNGKDVAVSYYHFDLMNNIQPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREGHPILFLYYEDLKKNPKKEIKKIANFLDKTLDEHTLERIVHHTSFEVMKDNPLVNYTHLPTEIMDHSKSPFMRKGVVGDWKNYFTMTQSEKFDAIYKKKLSGTTLEFCTDIQSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1564666 3'UTR Luciferase Stable Cell Line
TU219007 1.0 mL

RGD1564666 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CCKAR Antibody
A42338-50UG 50 µg

CCKAR Antibody

Sign In for Pricing
View Details
Rat Monoclonal TIM-2 Antibody (RM0134-5B23) [CoraFluor 1]
NBP1-22510CL1 0.1 mL

Rat Monoclonal TIM-2 Antibody (RM0134-5B23) [CoraFluor 1]

Sign In for Pricing
View Details
SLC5A12 Protein Vector (Rat) (pPM-C-HA)
PV306276 500 ng

SLC5A12 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
2-Naphthol 99% AR
01780 00500 500 g

2-Naphthol 99% AR

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (rC3e/1931), CF405S conjugate, 0.1mg/mL
BNC043644-100 1x 100 µL

CD3e (T-Cell Marker) (rC3e/1931), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details