Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal TNF protein

This Animal TNF protein spans the amino acid sequence from region 57-233aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cachectin TNF-alpha Tumor necrosis factor ligand superfamily member 2

UniProt

O35734

Expression Region

57-233aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Marmota monax (Woodchuck)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 10xHis-tagged and C-terminal Myc-tagged: N-terminal 10xHis-tagged1-200AA: 57-233AAFull Length : Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPQREEFLNNLPLSPQAQMLTLRSSSQNMNDKPVAHVVAKNEDKEQLVWLSRRANALLANGMELIDNQLVVPANGLYLVYSQVLFKGQGCPSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKESLEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MPPE1 shRNA (UAS) - Lentiviral human MPPE1 shRNA (UAS, RFP) (25)
GTR15101975 1 Vial

Lentiviral human MPPE1 shRNA (UAS) - Lentiviral human MPPE1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
BTK ligand-14
T206576-01 10 mg

BTK ligand-14

Sign In for Pricing
View Details
BTK ligand-14
T206576-02 50 mg

BTK ligand-14

Sign In for Pricing
View Details
CEACAM6 Protein, Human, Recombinant (His Tag)
E45H51097M2-100 100 µg

CEACAM6 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Normal Guinea pig IgG Isotype Control Antibody, APC
FWB96433 100 Tests

Normal Guinea pig IgG Isotype Control Antibody, APC

Sign In for Pricing
View Details
Flexible Tube Tygon® B-44-3
1462223 15 PK

Flexible Tube Tygon® B-44-3

Sign In for Pricing
View Details