What is the catalog number for Animal TNF protein?

The catalog number for Animal TNF protein is orb54762.

What sizes are available for Animal TNF protein?

Animal TNF protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Animal TNF protein come in?

Animal TNF protein is available in 3 different pack sizes.

Is Animal TNF protein in stock?

Animal TNF protein is currently made to order / not held in immediate stock. Contact us for lead time.

Animal TNF protein

This Animal TNF protein spans the amino acid sequence from region 57-233aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cachectin TNF-alpha Tumor necrosis factor ligand superfamily member 2

UniProt

O35734

Expression Region

57-233aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Marmota monax (Woodchuck)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 10xHis-tagged and C-terminal Myc-tagged: N-terminal 10xHis-tagged1-200AA: 57-233AAFull Length : Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPQREEFLNNLPLSPQAQMLTLRSSSQNMNDKPVAHVVAKNEDKEQLVWLSRRANALLANGMELIDNQLVVPANGLYLVYSQVLFKGQGCPSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKESLEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL