Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FAM167A protein

This human FAM167A protein spans the amino acid sequence from region 1-214aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FAM167A, C8orf13Protein FAM167A

UniProt

Q96KS9

Expression Region

1-214aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal FC-tagged: N-terminal 10xHis-tagged and C-terminal Myc-tagged1-153AA: 1-214AAFull Length: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF740 conjugate, 0.1mg/mL
BNC741930-100 1x 100 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMSB4Y Human Gene Knockout Kit (CRISPR)
KN418573 1 Kit

TMSB4Y Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Moesin (MSN) Mouse Monoclonal Antibody [Clone ID: MSN491]
AM50299PU-T 20 µg

Moesin (MSN) Mouse Monoclonal Antibody [Clone ID: MSN491]

Sign In for Pricing
View Details
Azi2 Mouse Gene Knockout Kit (CRISPR)
KN501901 1 Kit

Azi2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ASPG (NM_001080464) Human Recombinant Protein
TP318090L 1 mg

ASPG (NM_001080464) Human Recombinant Protein

Sign In for Pricing
View Details
COX4 (COX4I1) Rabbit Monoclonal Antibody
TA422285 100 µL

COX4 (COX4I1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details