Human FAM167A protein
This human FAM167A protein spans the amino acid sequence from region 1-214aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
FAM167A, C8orf13Protein FAM167A
UniProt
Q96KS9
Expression Region
1-214aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
28.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal FC-tagged: N-terminal 10xHis-tagged and C-terminal Myc-tagged1-153AA: 1-214AAFull Length: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CD34 Mouse Monoclonal Antibody [Clone ID: QBEnd-10]](https://cdn.genprice.uk/products/937/68dd189c061270361e8fca36/imageurl/am26038af-n.webp)
AM26038AF-N 100 µg
CD34 Mouse Monoclonal Antibody [Clone ID: QBEnd-10]
Sign In for Pricing
View Details 
![MAP3K13 Mouse Monoclonal Antibody [Clone ID: OTI5A2]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908d0e/imageurl/cf812277.webp)
CF812277 100 µg
MAP3K13 Mouse Monoclonal Antibody [Clone ID: OTI5A2]
Sign In for Pricing
View Details