Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial rplV protein

This Bacterial rplV protein spans the amino acid sequence from region 1-112aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RplV, APH_0285, 50S ribosomal protein L22

UniProt

Q2GL54

Expression Region

1-112aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Anaplasma phagocytophilum (strain HZ)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

NO-tagged: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged1-712AA: 1-112AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSIVIAAKGLGLRSTPAKLNLVADLIRGKDVAVAAMYLKFCKKKAALLIDKVLKSAIANARANYGVDADNLYVKEVLVGKAFTLRRVQPRARGRACRISKRYGSVVVKLLER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse HSP90b1 ELISA Kit
E051784 1 Each

Mouse HSP90b1 ELISA Kit

Sign In for Pricing
View Details
ARHGEF2 ORF Vector (Human) (pORF)
ORF000600 1.0 µg DNA

ARHGEF2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
RN5S181 Recombinant Protein (Human)
RP087204 100 µg

RN5S181 Recombinant Protein (Human)

Sign In for Pricing
View Details
Rnf126 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4671203 1.0 µg DNA

Rnf126 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
LAT antibody
70R-51374 100 ul

LAT antibody

Sign In for Pricing
View Details
SYNE2 siRNA (Human)
MBS8229893-01 15 nmol

SYNE2 siRNA (Human)

Sign In for Pricing
View Details