Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial rplV protein

This Bacterial rplV protein spans the amino acid sequence from region 1-112aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RplV, APH_0285, 50S ribosomal protein L22

UniProt

Q2GL54

Expression Region

1-112aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Anaplasma phagocytophilum (strain HZ)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

NO-tagged: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged1-712AA: 1-112AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSIVIAAKGLGLRSTPAKLNLVADLIRGKDVAVAAMYLKFCKKKAALLIDKVLKSAIANARANYGVDADNLYVKEVLVGKAFTLRRVQPRARGRACRISKRYGSVVVKLLER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptpn21 Rat shRNA Plasmid (Locus ID 171070)
TR712691 1 Kit

Ptpn21 Rat shRNA Plasmid (Locus ID 171070)

Sign In for Pricing
View Details
Me2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3777908 1.0 µg DNA

Me2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Atp7b sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3943103 1.0 µg DNA

Atp7b sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Mouse Malt1 / Mucosa-associated lymphoid tissue lymphoma translocation protein 1 homolog ELISA Kit
orb1653433 96 Tests

Mouse Malt1 / Mucosa-associated lymphoid tissue lymphoma translocation protein 1 homolog ELISA Kit

Sign In for Pricing
View Details
HMTase Inhibitor VI, BRD4770 (Methyl-2-benzamido-1- (3-phenylpropyl) -1H-benzo[d]imidazole-5-carboxylate) discontinued
217436 10 mg

HMTase Inhibitor VI, BRD4770 (Methyl-2-benzamido-1- (3-phenylpropyl) -1H-benzo[d]imidazole-5-carboxylate) discontinued

Sign In for Pricing
View Details
Cleaved-CASP3 (A175) Antibody
CSB-PA148736 100 µL

Cleaved-CASP3 (A175) Antibody

Sign In for Pricing
View Details