Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Galc protein

This Mouse Galc protein spans the amino acid sequence from region 43-684aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Galactocerebroside beta-galactosidase Galactosylceramidase Galactosylceramide beta-galactosidase

UniProt

P54818

Expression Region

43-684aa

Tag

Tag-Free

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

73.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged: NO-tagged26-638AA: 43-684AAExtracellular Domain: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGTPQQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACE2, Human (Biotinylated, HEK293, mFc-Avi)
HY-P700455 1 Each

ACE2, Human (Biotinylated, HEK293, mFc-Avi)

Sign In for Pricing
View Details
Daidzin 6''-O-malonate
TBW00945 10mg

Daidzin 6''-O-malonate

Sign In for Pricing
View Details
Recombinant Psychrobacter sp. Adenylosuccinate synthetase (purA)
MBS1145570-01 0.02 mg (E-Coli)

Recombinant Psychrobacter sp. Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details
Recombinant Psychrobacter sp. Adenylosuccinate synthetase (purA)
MBS1145570-02 0.02 mg (Yeast)

Recombinant Psychrobacter sp. Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details
Recombinant Psychrobacter sp. Adenylosuccinate synthetase (purA)
MBS1145570-03 0.1 mg (E-Coli)

Recombinant Psychrobacter sp. Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details
Recombinant Psychrobacter sp. Adenylosuccinate synthetase (purA)
MBS1145570-04 0.1 mg (Yeast)

Recombinant Psychrobacter sp. Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details