Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Galc protein

This Mouse Galc protein spans the amino acid sequence from region 43-684aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Galactocerebroside beta-galactosidase Galactosylceramidase Galactosylceramide beta-galactosidase

UniProt

P54818

Expression Region

43-684aa

Tag

Tag-Free

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

73.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged: NO-tagged26-638AA: 43-684AAExtracellular Domain: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGTPQQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKP1 Antibody
OACD06548-100UL 100 µL

PKP1 Antibody

Sign In for Pricing
View Details
Human FBXL5 (NM_012161) AAV Particle
RC216550A1V 250 µL

Human FBXL5 (NM_012161) AAV Particle

Sign In for Pricing
View Details
Type A 0.2ml Micro tube x 40pcs Block
4002642-3 1 Each

Type A 0.2ml Micro tube x 40pcs Block

Sign In for Pricing
View Details
Bovine Hemochromatosis Type 2/uvenile-Uman Homolog HFE2 ELISA Kit
BG-BVN11289 1 Each

Bovine Hemochromatosis Type 2/uvenile-Uman Homolog HFE2 ELISA Kit

Sign In for Pricing
View Details
Suclg2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6686808 1.0 µg DNA

Suclg2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
FBXW7 Antibody
orb252689 100 µL

FBXW7 Antibody

Sign In for Pricing
View Details