Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Tlr4 protein

This Rat Tlr4 protein spans the amino acid sequence from region 26-638aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD_antigen, CD284

UniProt

Q9QX05

Expression Region

26-638aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

90.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged1-764AA: 26-638AAFull Length : Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NPCIEVLPNITYQCMDQNLSKIPHDIPYSTKNLDLSFNPLKILRSYSFTNFSQLQWLDLSRCEIETIEDKAWHGLNQLSTLVLTGNPIKSFSPGSFSGLTNLENLVAVETKMTSLEGFHIGQLISLKKLNVAHNLIHSFKLPEYFSNLTNLEHVDLSYNYIQTISVKDLQFLRENPQVNLSLDLSLNPIDSIQAQAFQGIRLHELTLRSNFNSSNVLKMCLQNMTGLHVHRLILGEFKNERNLESFDRSVMEGLCNVSIDEFRLTYINHFSDDIYNLNCLANISAMSFTGVHIKHIADVPRHFKWQSLSIIRCHLKPFPKLSLPFLKSWTLTTNREDISFGQLALPSLRYLDLSRNAMSFRGCCSYSDFGTNNLKYLDLSFNGVILMSANFMGLEELEYLDFQHSTLKKVTEFSVFLSLEKLLYLDISYTNTKIDFDGIFLGLISLNTLKMAGNSFKDNTLSNVFTNTTNLTFLDLSKCQLEQISRGVFDTLYRLQLLNMSHNNLLFLDPSHYKQLYSLRTLDCSFNRIETSKGILQHFPKSLAVFNLTNNSVACICEYQNFLQWVKDQKMFLVNVEQMKCASPIDMKASLVLDFTNSTCYIYKTIISVSVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 5-bromo-1-naphthoate
449396-01 10 mg

Ethyl 5-bromo-1-naphthoate

Sign In for Pricing
View Details
Ethyl 5-bromo-1-naphthoate
449396-02 25 mg

Ethyl 5-bromo-1-naphthoate

Sign In for Pricing
View Details
SH3BP1 Antibody
orb1327116 100 µg

SH3BP1 Antibody

Sign In for Pricing
View Details
Interleukin-8, Recombinant, Human (CXCL8, IL-8) discontinued. See I8430-10
214954 25 µg

Interleukin-8, Recombinant, Human (CXCL8, IL-8) discontinued. See I8430-10

Sign In for Pricing
View Details
Lentiviral human CRCT1 shRNA (UAS) - Lentiviral human CRCT1 shRNA (UAS) (25)
GTR15328652 1 Vial

Lentiviral human CRCT1 shRNA (UAS) - Lentiviral human CRCT1 shRNA (UAS) (25)

Sign In for Pricing
View Details
CALCA siRNA (Mouse)
MBS8219003-01 15 nmol

CALCA siRNA (Mouse)

Sign In for Pricing
View Details