Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Tlr4 protein

This Rat Tlr4 protein spans the amino acid sequence from region 26-638aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD_antigen, CD284

UniProt

Q9QX05

Expression Region

26-638aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

90.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged1-764AA: 26-638AAFull Length : Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NPCIEVLPNITYQCMDQNLSKIPHDIPYSTKNLDLSFNPLKILRSYSFTNFSQLQWLDLSRCEIETIEDKAWHGLNQLSTLVLTGNPIKSFSPGSFSGLTNLENLVAVETKMTSLEGFHIGQLISLKKLNVAHNLIHSFKLPEYFSNLTNLEHVDLSYNYIQTISVKDLQFLRENPQVNLSLDLSLNPIDSIQAQAFQGIRLHELTLRSNFNSSNVLKMCLQNMTGLHVHRLILGEFKNERNLESFDRSVMEGLCNVSIDEFRLTYINHFSDDIYNLNCLANISAMSFTGVHIKHIADVPRHFKWQSLSIIRCHLKPFPKLSLPFLKSWTLTTNREDISFGQLALPSLRYLDLSRNAMSFRGCCSYSDFGTNNLKYLDLSFNGVILMSANFMGLEELEYLDFQHSTLKKVTEFSVFLSLEKLLYLDISYTNTKIDFDGIFLGLISLNTLKMAGNSFKDNTLSNVFTNTTNLTFLDLSKCQLEQISRGVFDTLYRLQLLNMSHNNLLFLDPSHYKQLYSLRTLDCSFNRIETSKGILQHFPKSLAVFNLTNNSVACICEYQNFLQWVKDQKMFLVNVEQMKCASPIDMKASLVLDFTNSTCYIYKTIISVSVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish FN1A Rabbit Polyclonal Antibody (Fluoro550)
orb3091030 100 µg

Zebrafish FN1A Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Parkin Rabbit Polyclonal Antibody (BF555)
orb2444032 100 µL

Parkin Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
PTPN11, CT (Tyrosine-protein Phosphatase Non-receptor Type 11, Protein-tyrosine Phosphatase 2C, PTP-2C, Protein-tyrosine Phosphatase 1D, PTP-1D, SH-PTP3, SH-PTP2, SHP-2, Shp2, SHPTP2, PTP2C)
MBS630018-01 0.2 mL

PTPN11, CT (Tyrosine-protein Phosphatase Non-receptor Type 11, Protein-tyrosine Phosphatase 2C, PTP-2C, Protein-tyrosine Phosphatase 1D, PTP-1D, SH-PTP3, SH-PTP2, SHP-2, Shp2, SHPTP2, PTP2C)

Sign In for Pricing
View Details
PTPN11, CT (Tyrosine-protein Phosphatase Non-receptor Type 11, Protein-tyrosine Phosphatase 2C, PTP-2C, Protein-tyrosine Phosphatase 1D, PTP-1D, SH-PTP3, SH-PTP2, SHP-2, Shp2, SHPTP2, PTP2C)
MBS630018-02 5x 0.2 mL

PTPN11, CT (Tyrosine-protein Phosphatase Non-receptor Type 11, Protein-tyrosine Phosphatase 2C, PTP-2C, Protein-tyrosine Phosphatase 1D, PTP-1D, SH-PTP3, SH-PTP2, SHP-2, Shp2, SHPTP2, PTP2C)

Sign In for Pricing
View Details
Recombinant MART-1 Antibody / Melan-A
V8729SAF-100UG 100 µg

Recombinant MART-1 Antibody / Melan-A

Sign In for Pricing
View Details
ASPN (Asporin, Periodontal Ligament-associated Protein 1, PLAP-1, SLRR1C, PLAP1, UNQ215/PRO241, FLJ20129) (MaxLight 405) discontinued
123643-ML405 100 µL

ASPN (Asporin, Periodontal Ligament-associated Protein 1, PLAP-1, SLRR1C, PLAP1, UNQ215/PRO241, FLJ20129) (MaxLight 405) discontinued

Sign In for Pricing
View Details