Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Asah1 protein

This Mouse Asah1 protein spans the amino acid sequence from region 19-141aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Acylsphingosine deacylase N-acylsphingosine amidohydrolase

UniProt

Q9WV54

Expression Region

19-141aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged18-279AA: 19-141AAExtracellular Domain: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus aureus Protein GlcT (glcT)
MBS1234548-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Protein GlcT (glcT)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Protein GlcT (glcT)
MBS1234548-02 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Protein GlcT (glcT)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Protein GlcT (glcT)
MBS1234548-03 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Protein GlcT (glcT)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Protein GlcT (glcT)
MBS1234548-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus Protein GlcT (glcT)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Protein GlcT (glcT)
MBS1234548-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus aureus Protein GlcT (glcT)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Protein GlcT (glcT)
MBS1234548-06 0.02 mg (Mammalian-Cell)

Recombinant Staphylococcus aureus Protein GlcT (glcT)

Sign In for Pricing
View Details