Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cbln3 protein

This Mouse Cbln3 protein spans the amino acid sequence from region 25-197aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cbln3Cerebellin-3

UniProt

Q9JHG0

Expression Region

25-197aa

Tag

N-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged: N-terminal 6xHis-SUMO-tagged21-248AA: 25-197AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF405S conjugate, 0.1mg/mL
BNC042259-500 1x 500 µL

Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD23 (Fc Epsilon RII) (FCER2/3592), 1mg/mL
BNUM3592-50 1x 50 µL

CD23 (Fc Epsilon RII) (FCER2/3592), 1mg/mL

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) ICP8 (HSVI/2045), CF568 conjugate, 0.1mg/mL
BNC682045-500 1x 500 µL

HSV1 (Herpes Simplex Virus Type I) ICP8 (HSVI/2045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ExoBrite™ 650/665 CD9 Flow Antibody (25 tests)
P003-650-125 125 μL

ExoBrite™ 650/665 CD9 Flow Antibody (25 tests)

Sign In for Pricing
View Details
Recombinant Human TL1A Protein (Fc Tag)
PKSH030438 100 µg

Recombinant Human TL1A Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant BMP6 Monoclonal Antibody
AN301448L-01 50 µL

Recombinant BMP6 Monoclonal Antibody

Sign In for Pricing
View Details