Mouse Cbln3 protein
This Mouse Cbln3 protein spans the amino acid sequence from region 25-197aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cbln3Cerebellin-3
UniProt
Q9JHG0
Expression Region
25-197aa
Tag
N-terminal 6xHis-tagged
Source
In vitro E.coli expression system
Origin
Mus musculus (Mouse)
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
22.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged: N-terminal 6xHis-SUMO-tagged21-248AA: 25-197AAFull Length : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC473645-500 1x 500 µL
CD61 / Integrin '3 / Platelet Glycoprotein IIIa (Platelet Marker) (rITGB3/2145), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUM1775-50 1x 50 µL
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), 1mg/mL
Sign In for Pricing
View Details 
PKSM040352 100 µg
Recombinant Mouse IL17BR/IL17RB Protein (His Tag)
Sign In for Pricing
View Details 
BNUM2343-50 1x 50 µL
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/2343), 1mg/mL
Sign In for Pricing
View Details 
PKSV030473 100 µg
Recombinant SARS-CoV-2 Spike S1 NTD Protein (ECD, C-His Tag) (Omicron)
Sign In for Pricing
View Details 
BNC941603-100 1x 100 µL
CD1c (CD1C/1603), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details