Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SFTPA1 protein

This Human SFTPA1 protein spans the amino acid sequence from region 21-248aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collectin-4

UniProt

Q8IWL2

Expression Region

21-248aa

Tag

N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged106-222AA: 21-248AAPartial: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG2A Knockout Raji Polyclonal Cells
ARG21297 1 Million

ATG2A Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
KRTAP2-5P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV730657 1.0 µg DNA

KRTAP2-5P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Phospho-BCAR1 (Tyr249) Polyclonal Antibody, FITC Conjugated
bs-12574R-FITC 100 µL

Phospho-BCAR1 (Tyr249) Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
MIR4746 Human qPCR Template Standard (MI0017385)
HK301132 200 Reactions

MIR4746 Human qPCR Template Standard (MI0017385)

Sign In for Pricing
View Details
Recombinant Monosiga brevicollis Structure-specific endonuclease subunit SLX1 homolog (8836)
MBS1043228-01 0.02 mg (E-Coli)

Recombinant Monosiga brevicollis Structure-specific endonuclease subunit SLX1 homolog (8836)

Sign In for Pricing
View Details
Recombinant Monosiga brevicollis Structure-specific endonuclease subunit SLX1 homolog (8836)
MBS1043228-02 0.02 mg (Yeast)

Recombinant Monosiga brevicollis Structure-specific endonuclease subunit SLX1 homolog (8836)

Sign In for Pricing
View Details