Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SFTPA1 protein

This Human SFTPA1 protein spans the amino acid sequence from region 21-248aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collectin-4

UniProt

Q8IWL2

Expression Region

21-248aa

Tag

N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged106-222AA: 21-248AAPartial: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CR ELISA Kit
E006249 1 Each

Human CR ELISA Kit

Sign In for Pricing
View Details
RPL32P16 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV779936 1.0 µg DNA

RPL32P16 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Zcchc10 (NM_026479) Mouse Tagged ORF Clone
MG201561 10 µg

Zcchc10 (NM_026479) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Magi1 Rat Pre-designed siRNA Set A
HY-RS26953 1 Set

Magi1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rat Selenoprotein P ELISA Kit
MBS3809849-01 48 Well

Rat Selenoprotein P ELISA Kit

Sign In for Pricing
View Details
Rat Selenoprotein P ELISA Kit
MBS3809849-02 96 Well

Rat Selenoprotein P ELISA Kit

Sign In for Pricing
View Details