What is the catalog number for Viral VACWR090 protein?

The catalog number for Viral VACWR090 protein is orb54723.

What sizes are available for Viral VACWR090 protein?

Viral VACWR090 protein is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Viral VACWR090 protein come in?

Viral VACWR090 protein is available in 2 different pack sizes.

Is Viral VACWR090 protein in stock?

Viral VACWR090 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Viral VACWR090 protein

This Viral VACWR090 protein spans the amino acid sequence from region 1-350aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein F4

UniProt

P07614

Expression Region

1-350aa

Tag

N-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged: N-terminal 6xHis-tagged20-576AA: 1-350AAPartial: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNTRTDVTNDNIDKNPTKRGDKNIPGRNERFNDQNRFNNDIPKPKPRLQPNQPPKQDNKCREENGDFINIRLCAYEKEYCNDGYLSPAYYMLKQVDDEEMSCWSELSSLVRSRKAVGFPLLKAAKRISHGSMLYFEQFKNSKVVRLTPQVKCLNDTVIFQTVVILYSMYKRGIYSNEFCFDLVSIPRTNIVFSVNQLMFNICTDILVVLSICGNRLYRTNLPQSCYLNFIHGHETIARRGYEHSNYFFEWLIKNHISLLTKQTMDILKVKKKYAIGAPVNRLLEPGTLVYVPKEDYYFIGISLTDVSISDNVRVLFSTDGIVLEIEDFNIKHLFMAGEMFVRSQSSTIIV