Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tectb protein

This Mouse Tectb protein spans the amino acid sequence from region 18-305aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tectb, Beta-tectorin

UniProt

O08524

Expression Region

18-305aa

Tag

N-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged1-490AA: 18-305AAFull Length : Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSCTPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDSTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSTKKEAPFVLETSEIGSDLFAGVEAKGLSVRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGKDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVNCDKRKRMLRDQTGGVLVVELSLRSRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CARD 10 Rabbit Polyclonal Antibody
APRab07923-01 20 µL

CARD 10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CARD 10 Rabbit Polyclonal Antibody
APRab07923-02 50 µL

CARD 10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CARD 10 Rabbit Polyclonal Antibody
APRab07923-03 100 µL

CARD 10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CARD 10 Rabbit Polyclonal Antibody
APRab07923-04 200 µL

CARD 10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gjc1 (NM_008122) Mouse Tagged ORF Clone Lentiviral Particle
MR220955L4V 200 µL

Gjc1 (NM_008122) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RPS20P5 3'UTR Lenti-reporter-Luc Vector
42240081 1.0 µg

RPS20P5 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details