What is the catalog number for Mouse Tectb protein?

The catalog number for Mouse Tectb protein is orb54719.

What sizes are available for Mouse Tectb protein?

Mouse Tectb protein is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Mouse Tectb protein come in?

Mouse Tectb protein is available in 2 different pack sizes.

Is Mouse Tectb protein in stock?

Mouse Tectb protein is currently made to order / not held in immediate stock. Contact us for lead time.

Mouse Tectb protein

This Mouse Tectb protein spans the amino acid sequence from region 18-305aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tectb, Beta-tectorin

UniProt

O08524

Expression Region

18-305aa

Tag

N-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-tagged1-490AA: 18-305AAFull Length : Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSCTPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDSTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSTKKEAPFVLETSEIGSDLFAGVEAKGLSVRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGKDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVNCDKRKRMLRDQTGGVLVVELSLRSRA