Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human REXO4 protein

This Human REXO4 protein spans the amino acid sequence from region 1-422aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Exonuclease XPMC2 Prevents mitotic catastrophe 2 protein homolog Short name, hPMC2

UniProt

Q9GZR2

Expression Region

1-422aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged29-760AA: 1-422AAExtracellular Domain: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGKAKVPASKRAPSSPVAKPGPVKTLTRKKNKKKKRFWKSKAREVSKKPASGPGAVVRPPKAPEDFSQNWKALQEWLLKQKSQAPEKPLVISQMGSKKKPKIIQQNKKETSPQVKGEEMPAGKDQEASRGSVPSGSKMDRRAPVPRTKASGTEHNKKGTKERTNGDIVPERGDIEHKKRKAKEAAPAPPTEEDIWFDDVDPADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALALDCEMVGVGPKGEESMAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQGEELEVVQKEVAEMLKGRILVGHALHNDLKVLFLDHPKKKIRDTQKYKPFKSQVKSGRPSLRLLSEKILGLQVQQAEHCSIQDAQAAMRLYVMVKKEWESMARDRRPLLTAPDHCSDDA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human NSE (Neuron Specific Enolase) ELISA Kit
MBS2571620-01 24 Tests (Limit 1)

Uncoated Human NSE (Neuron Specific Enolase) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human NSE (Neuron Specific Enolase) ELISA Kit
MBS2571620-02 5x 96 Tests

Uncoated Human NSE (Neuron Specific Enolase) ELISA Kit

Sign In for Pricing
View Details
mPEG-NB, 10K
MF001279-10K Inquire

mPEG-NB, 10K

Sign In for Pricing
View Details
Mouse Nfatc2 activation kit by CRISPRa
GA202871 1 Kit

Mouse Nfatc2 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Neuropeptide Y (NP-Y) ELISA Kit
orb2812587-01 48 Tests

Mouse Neuropeptide Y (NP-Y) ELISA Kit

Sign In for Pricing
View Details
Mouse Neuropeptide Y (NP-Y) ELISA Kit
orb2812587-02 96 Tests

Mouse Neuropeptide Y (NP-Y) ELISA Kit

Sign In for Pricing
View Details