Dog Cationic trypsin protein
This Dog Cationic trypsin protein spans the amino acid sequence from region 24-246aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cationic trypsin, EC 3.4.21.4
UniProt
P06871
Expression Region
24-246aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
In vitro E.coli expression system
Origin
Canis lupus familiaris (Dog) (Canis familiaris)
Field of Research
Epigenetics
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
39.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged24-247AA: 24-246AAFull Length : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVCKYVSWIQQTIAAN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Livin (BIRC7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D12]](https://cdn.genprice.uk/products/937/6868c319994c49e6dc3eee46/imageurl/ta500758am.webp)
TA500758AM 100 µL
Livin (BIRC7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D12]
Sign In for Pricing
View Details ![ICAM1 Mouse Monoclonal Antibody [Clone ID: B-H17]](https://cdn.genprice.uk/products/937/68dd189d061270361e8fd228/imageurl/am31187fc-n.webp)
AM31187FC-N 1 mL (100 Tests)
ICAM1 Mouse Monoclonal Antibody [Clone ID: B-H17]
Sign In for Pricing
View Details 
E-CL-H0140-01 24 Tests
Human GLP-1 (Glucagon Like Peptide 1) CLIA Kit
Sign In for Pricing
View Details E-CL-H0140-02 48 Tests
Human GLP-1 (Glucagon Like Peptide 1) CLIA Kit
Sign In for Pricing
View Details E-CL-H0140-03 96 Tests
Human GLP-1 (Glucagon Like Peptide 1) CLIA Kit
Sign In for Pricing
View Details 
TRC-D985220-10MG 10 mg
9,10-Dihydro-9,10-ethanoanthracene-9-acrolein
Sign In for Pricing
View Details