Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog Cationic trypsin protein

This Dog Cationic trypsin protein spans the amino acid sequence from region 24-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cationic trypsin, EC 3.4.21.4

UniProt

P06871

Expression Region

24-246aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged24-247AA: 24-246AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVCKYVSWIQQTIAAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr791 ORF Vector (Rat) (pORF)
ORF072792 1.0 µg DNA

Olr791 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
GoSlo-SR-5-69
BA6928-5 5 mg

GoSlo-SR-5-69

Sign In for Pricing
View Details
SLC17A7 ORF Vector (Human) (pORF)
ORF032369 1.0 µg DNA

SLC17A7 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Zinc phosphodiesterase ELAC protein 1, ELAC1 ELISA Kit
MBS9326143-01 48 Well

Mouse Zinc phosphodiesterase ELAC protein 1, ELAC1 ELISA Kit

Sign In for Pricing
View Details
Mouse Zinc phosphodiesterase ELAC protein 1, ELAC1 ELISA Kit
MBS9326143-02 96 Well

Mouse Zinc phosphodiesterase ELAC protein 1, ELAC1 ELISA Kit

Sign In for Pricing
View Details
Mouse Zinc phosphodiesterase ELAC protein 1, ELAC1 ELISA Kit
MBS9326143-03 5x 96 Well

Mouse Zinc phosphodiesterase ELAC protein 1, ELAC1 ELISA Kit

Sign In for Pricing
View Details