Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog Anionic trypsin protein

This Dog Anionic trypsin protein spans the amino acid sequence from region 24-247aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Anionic trypsin, EC 3.4.21.4

UniProt

P06872

Expression Region

24-247aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-B2M-tagged: N-terminal 6xHis-SUMO-tagged1-391AA: 24-247AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGYTCEENSVPYQVSLNAGYHFCGGSLISDQWVVSAAHCYKSRIQVRLGEYNIDVLEGNEQFINSAKVIRHPNYNSWILDNDIMLIKLSSPAVLNARVATISLPRACAAPGTQCLISGWGNTLSSGTNYPELLQCLDAPILTQAQCEASYPGQITENMICAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKNKPGVYTKVCNFVDWIQSTIAANS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R14A (Protein Phosphatase 1 Regulatory Subunit 14A, 17kD PKC-potentiated Inhibitory Protein of PP1, Protein Kinase C-potentiated Inhibitor Protein of 17kD, CPI-17, CPI17, PPP1INL) (PE)
MBS6159609-01 0.1 mL

PPP1R14A (Protein Phosphatase 1 Regulatory Subunit 14A, 17kD PKC-potentiated Inhibitory Protein of PP1, Protein Kinase C-potentiated Inhibitor Protein of 17kD, CPI-17, CPI17, PPP1INL) (PE)

Sign In for Pricing
View Details
PPP1R14A (Protein Phosphatase 1 Regulatory Subunit 14A, 17kD PKC-potentiated Inhibitory Protein of PP1, Protein Kinase C-potentiated Inhibitor Protein of 17kD, CPI-17, CPI17, PPP1INL) (PE)
MBS6159609-02 5x 0.1 mL

PPP1R14A (Protein Phosphatase 1 Regulatory Subunit 14A, 17kD PKC-potentiated Inhibitory Protein of PP1, Protein Kinase C-potentiated Inhibitor Protein of 17kD, CPI-17, CPI17, PPP1INL) (PE)

Sign In for Pricing
View Details
INSL4 Antibody
A14445-50UG 50 µg

INSL4 Antibody

Sign In for Pricing
View Details
ZMAT2 Conjugated Antibody
C43571 100 µL

ZMAT2 Conjugated Antibody

Sign In for Pricing
View Details
Gemin 1 Conjugated Antibody
MBS9457509-01 0.1 mL (Biotin)

Gemin 1 Conjugated Antibody

Sign In for Pricing
View Details
Gemin 1 Conjugated Antibody
MBS9457509-02 0.1 mL (AF350)

Gemin 1 Conjugated Antibody

Sign In for Pricing
View Details