Human BPIFA1 protein
This Human BPIFA1 protein spans the amino acid sequence from region 20-256aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Lung-specific protein X Nasopharyngeal carcinoma-related protein Palate lung and nasal epithelium clone protein Secretory protein in upper respiratory tracts Short PLUNC1 Short name, SPLUNC1 Tracheal epithelium-enriched protein Von Ebner protein Hl
UniProt
Q9NP55
Expression Region
20-256aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
In vitro E.coli expression system
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
40.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal 6xHis-tagged: N-terminal 6xHis-SUMO-tagged1-707AA: 20-256AAFull Length : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
J7999-02-Biotin 200 µL
Jun D (Jun D Proto-oncogene, JunD, AP-1, Transcription Factor Jun-D) (Biotin) discontinued
Sign In for Pricing
View Details 
MBS738546-01 48 Well
Porcine Cross linked C terminal Telopeptide of type I Collagen (CTX1) ELISA Kit
Sign In for Pricing
View Details MBS738546-02 96 Well
Porcine Cross linked C terminal Telopeptide of type I Collagen (CTX1) ELISA Kit
Sign In for Pricing
View Details MBS738546-03 5x 96 Well
Porcine Cross linked C terminal Telopeptide of type I Collagen (CTX1) ELISA Kit
Sign In for Pricing
View Details MBS738546-04 10x 96 Well
Porcine Cross linked C terminal Telopeptide of type I Collagen (CTX1) ELISA Kit
Sign In for Pricing
View Details 