Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BPIFA1 protein

This Human BPIFA1 protein spans the amino acid sequence from region 20-256aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lung-specific protein X Nasopharyngeal carcinoma-related protein Palate lung and nasal epithelium clone protein Secretory protein in upper respiratory tracts Short PLUNC1 Short name, SPLUNC1 Tracheal epithelium-enriched protein Von Ebner protein Hl

UniProt

Q9NP55

Expression Region

20-256aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-SUMO-tagged1-707AA: 20-256AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza NA Antibody
orb2949930-01 5 mg

Influenza NA Antibody

Sign In for Pricing
View Details
Influenza NA Antibody
orb2949930-02 1 mg

Influenza NA Antibody

Sign In for Pricing
View Details
OR5B3 Rabbit Polyclonal Antibody
TA316469 100 µL

OR5B3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-DPPI Antibody
MBS415345-01 0.1 mL

Anti-DPPI Antibody

Sign In for Pricing
View Details
Anti-DPPI Antibody
MBS415345-02 5x 0.1 mL

Anti-DPPI Antibody

Sign In for Pricing
View Details
Norwogonoside
TBW00795 10mg

Norwogonoside

Sign In for Pricing
View Details