Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HTR3E protein

This Human HTR3E protein spans the amino acid sequence from region 72-228aa&241-456aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serotonin receptor 3E

UniProt

A5X5Y0

Expression Region

72-228aa&241-456aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged38-693AA: 72-228AA&241-456AAPartial: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NR1D1 Protein, N-His
orb3059305-01 50 µg

Recombinant Human NR1D1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human NR1D1 Protein, N-His
orb3059305-02 100 µg

Recombinant Human NR1D1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human NR1D1 Protein, N-His
orb3059305-03 1 mg

Recombinant Human NR1D1 Protein, N-His

Sign In for Pricing
View Details
Plexin D1 Rabbit pAb, Pacific Blue conjugated
orb2858645 100 µL

Plexin D1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Phospho-RPS6KB2 (Ser370) Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-62973R-BF647 100 µL

Phospho-RPS6KB2 (Ser370) Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Olfr19 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3928903 1.0 µg DNA

Olfr19 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details