Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human APH1a protein

This Human APH1a protein spans the amino acid sequence from region 1-247aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aph-1alpha Presenilin-stabilization factor

UniProt

Q96BI3

Expression Region

1-247aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged1-75AA: 1-247AAPartial: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CELF-1
E8EM1701-77 100 µL

CELF-1

Sign In for Pricing
View Details
(1- (4-Methylbenzyl) piperidin-4-yl) methanol
OR1050805-01 100 mg

(1- (4-Methylbenzyl) piperidin-4-yl) methanol

Sign In for Pricing
View Details
(1- (4-Methylbenzyl) piperidin-4-yl) methanol
OR1050805-02 250 mg

(1- (4-Methylbenzyl) piperidin-4-yl) methanol

Sign In for Pricing
View Details
Anti-BEST1 Antibody (FITC)
STJ500242 100 µg

Anti-BEST1 Antibody (FITC)

Sign In for Pricing
View Details
Ogfod2 (NM_025671) Mouse Tagged Lenti ORF Clone
MR205271L4 10 µg

Ogfod2 (NM_025671) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
C10orf105 Double Nickase Plasmid (h)
sc-416008-NIC 20 µg

C10orf105 Double Nickase Plasmid (h)

Sign In for Pricing
View Details