Fish Salmo salar Vertebrate ancient opsin protein
This Fish Salmo salar Vertebrate ancient opsin protein spans the amino acid sequence from region 1-75aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Vertebrate ancient opsin
UniProt
O13018
Expression Region
1-75aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
In vitro E.coli expression system
Origin
Salmo salar (Atlantic salmon)
Field of Research
Epigenetics, GPCR, Neuroscience, Signaling Pathways
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
24.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged1-82AA: 1-75AAPartial: Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![TRAIL (TNFSF10) Mouse Monoclonal Antibody [Clone ID: OTI12E12]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908bee/imageurl/cf811771.webp)
CF811771 100 µg
TRAIL (TNFSF10) Mouse Monoclonal Antibody [Clone ID: OTI12E12]
Sign In for Pricing
View Details 
GM-15-15 1 mL
Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex I, 15nm
Sign In for Pricing
View Details 
