Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish Salmo salar Vertebrate ancient opsin protein

This Fish Salmo salar Vertebrate ancient opsin protein spans the amino acid sequence from region 1-75aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vertebrate ancient opsin

UniProt

O13018

Expression Region

1-75aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Salmo salar (Atlantic salmon)

Field of Research

Epigenetics, GPCR, Neuroscience, Signaling Pathways

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged1-82AA: 1-75AAPartial: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Orexin A (OXA) ELISA Kit
RD-OXA-b-01 96 Tests

Bovine Orexin A (OXA) ELISA Kit

Sign In for Pricing
View Details
Bovine Orexin A (OXA) ELISA Kit
RD-OXA-b-02 48 Tests

Bovine Orexin A (OXA) ELISA Kit

Sign In for Pricing
View Details
L1CAM Antibody
KC-1806-01 50 μL

L1CAM Antibody

Sign In for Pricing
View Details
L1CAM Antibody
KC-1806-02 100 µL

L1CAM Antibody

Sign In for Pricing
View Details
L1CAM Antibody
KC-1806-03 1 mL

L1CAM Antibody

Sign In for Pricing
View Details
CD80 Recombinant Mouse monoclonal Antibody
HA610122 100 µg

CD80 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details