Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EDNRA protein

This human EDNRA protein spans the amino acid sequence from region 21-427aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endothelin A receptor

UniProt

P25101

Expression Region

21-427aa

Tag

C-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

C-terminal 10xHis-tagged: C-terminal 10xHis-tagged27

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MKP-3 Conjugated Antibody
orb1612352 100 µL

MKP-3 Conjugated Antibody

Sign In for Pricing
View Details
Streptavidin
orb372221 1 mg

Streptavidin

Sign In for Pricing
View Details
Mouse Calbindin ELISA Kit
MBS9426580-01 96 Tests

Mouse Calbindin ELISA Kit

Sign In for Pricing
View Details
Mouse Calbindin ELISA Kit
MBS9426580-02 5x 96 Tests

Mouse Calbindin ELISA Kit

Sign In for Pricing
View Details
Tox/Tox2 (E6I3Q) Rabbit Monoclonal Antibody
CST 73758S 100 µL

Tox/Tox2 (E6I3Q) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
POU2F1 (POU Domain, Class 2, Transcription Factor 1, NF-A1, Octamer-binding Protein 1, Oct-1, Octamer-binding Transcription Factor 1, OTF-1, OCT1, OTF1) (MaxLight 750)
MBS6234630-01 0.1 mL

POU2F1 (POU Domain, Class 2, Transcription Factor 1, NF-A1, Octamer-binding Protein 1, Oct-1, Octamer-binding Transcription Factor 1, OTF-1, OCT1, OTF1) (MaxLight 750)

Sign In for Pricing
View Details