Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MARCH2 protein

This human MARCH2 protein spans the amino acid sequence from region 1-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Membrane-associated RING finger protein 2 Membrane-associated RING-CH protein II

UniProt

Q9P0N8

Expression Region

1-246aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged1-219AA: 1-246AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Mesothelin Antibody
NBP1-88224-25ul 25 µL

Rabbit Polyclonal Mesothelin Antibody

Sign In for Pricing
View Details
Gpx8 ORF Vector (Rat) (pORF)
ORF067852 1.0 µg DNA

Gpx8 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Presenilin 1 antibody
20R-1603 100 ug

Presenilin 1 antibody

Sign In for Pricing
View Details
TRNAP11 sgRNA CRISPR Lentivector (Human) (Target 3)
K2511104 1.0 µg DNA

TRNAP11 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. syringae CTP synthase (pyrG), partial
MBS1397601 Inquire

Recombinant Pseudomonas syringae pv. syringae CTP synthase (pyrG), partial

Sign In for Pricing
View Details
(R) -3-Amino-4- (2,4,5-trifluorophenyl) butanoic acid HCI
260022-01 25 mg

(R) -3-Amino-4- (2,4,5-trifluorophenyl) butanoic acid HCI

Sign In for Pricing
View Details