Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KCNJ10 protein

This human KCNJ10 protein spans the amino acid sequence from region 1-379aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP-dependent inwardly rectifying potassium channel Kir4.1 Inward rectifier K (+) channel Kir1.2 Potassium channel, inwardly rectifying subfamily J member 10

UniProt

P78508

Expression Region

1-379aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged2-79AA: 1-379AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD8B (C-Fc)
C03D-10ug 10 µg

Recombinant Human CD8B (C-Fc)

Sign In for Pricing
View Details
Ku80 Recombinant Antibody, Cy3 Conjugated
bsm-52512R-Cy3 100 µL

Ku80 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
CLPTM1 Human Over-expression Lysate
orb1378965 20 µg

CLPTM1 Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-p53 (pS37) Phospho Antibody
MBS8224094-01 0.03 mL

Anti-p53 (pS37) Phospho Antibody

Sign In for Pricing
View Details
Anti-p53 (pS37) Phospho Antibody
MBS8224094-02 0.05 mL

Anti-p53 (pS37) Phospho Antibody

Sign In for Pricing
View Details
Anti-p53 (pS37) Phospho Antibody
MBS8224094-03 0.1 mL

Anti-p53 (pS37) Phospho Antibody

Sign In for Pricing
View Details