Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral VACWR074 protein

This Viral VACWR074 protein spans the amino acid sequence from region 2-79aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein VP13K

UniProt

P12924

Expression Region

2-79aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-SUMO-tagged1-231AA: 2-79AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VDAITVLTAIGITVLMLLMVISGAALIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYVKSLLMKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Testis
CR562618 5 µg

Tissue Total RNA, Testis

Sign In for Pricing
View Details
DDA1 Rabbit Polyclonal Antibody
TA365730 100 µL

DDA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SMYD1 Human Gene Knockout Kit (CRISPR)
KN421269 1 Kit

SMYD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human KRTAP10-1 activation kit by CRISPRa
GA117862 1 Kit

Human KRTAP10-1 activation kit by CRISPRa

Sign In for Pricing
View Details
Thymidine Phosphorylase (TYMP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G10]
TA800961BM 100 µL

Thymidine Phosphorylase (TYMP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G10]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ileum
CS642427 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details