Viral VACWR074 protein
This Viral VACWR074 protein spans the amino acid sequence from region 2-79aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Protein VP13K
UniProt
P12924
Expression Region
2-79aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
In vitro E.coli expression system
Origin
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
24.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal 6xHis-tagged: N-terminal 6xHis-SUMO-tagged1-231AA: 2-79AAFull Length : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
VDAITVLTAIGITVLMLLMVISGAALIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYVKSLLMKS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mutarotase (GALM) Mouse Monoclonal Antibody [Clone ID: OTI7B7]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908d17/imageurl/cf812291.webp)
CF812291 100 µg
Mutarotase (GALM) Mouse Monoclonal Antibody [Clone ID: OTI7B7]
Sign In for Pricing
View Details ![iFluor™ 647 Conjugated Cytokeratin 16 Recombinant Rabbit Monoclonal Antibody [SC52-09]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81b82/imageurl/ha720149f.webp)
HA720149F 100 µL
iFluor™ 647 Conjugated Cytokeratin 16 Recombinant Rabbit Monoclonal Antibody [SC52-09]
Sign In for Pricing
View Details 
BNC042839-100 1x 100 µL
Desmoglein-3 (Squamous Cell Marker) (DSG3/2839), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC402781 20 µg
RepuLsive Guidance MolecuLe A (RGMA) (NM_020211) Human Over-expression Lysate
Sign In for Pricing
View Details 