Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral VACWR074 protein

This Viral VACWR074 protein spans the amino acid sequence from region 2-79aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein VP13K

UniProt

P12924

Expression Region

2-79aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-SUMO-tagged1-231AA: 2-79AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VDAITVLTAIGITVLMLLMVISGAALIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYVKSLLMKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Mouse CD127/IL-7RA Antibody[A7R34]
E-AB-F1023E-01 50 Tests

APC Anti-Mouse CD127/IL-7RA Antibody[A7R34]

Sign In for Pricing
View Details
APC Anti-Mouse CD127/IL-7RA Antibody[A7R34]
E-AB-F1023E-02 100 Tests

APC Anti-Mouse CD127/IL-7RA Antibody[A7R34]

Sign In for Pricing
View Details
APC Anti-Mouse CD127/IL-7RA Antibody[A7R34]
E-AB-F1023E-03 2x 100 Tests

APC Anti-Mouse CD127/IL-7RA Antibody[A7R34]

Sign In for Pricing
View Details
Apc6 (CDC16) (NM_001078645) Human Over-expression Lysate
LC421501 20 µg

Apc6 (CDC16) (NM_001078645) Human Over-expression Lysate

Sign In for Pricing
View Details
LLGL2 (C-term) Rabbit Polyclonal Antibody
AP12121PU-N 400 µL

LLGL2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thyroid Hormone Receptor beta (THRB) Rabbit Polyclonal Antibody
AP06354PU-N 100 µg

Thyroid Hormone Receptor beta (THRB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details