Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial laaA protein

This Bacterial laaA protein spans the amino acid sequence from region 1-310aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LaaAL-amino acid amidase, EC 3.5.1.101

UniProt

Q76KX0

Expression Region

1-310aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Pseudomonas azotoformans

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged1-353AA: 1-310AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEFIEKIREGYAAFGAYQTWYRVTGDLSSGRTPLVVIHGGPGCTHDYVDAFKDVAASGHAVIHYDQLGNGRSTHLPDKDPSFWTVGLFLEELNNLLDHLQISDNYAILGQSWGGMLGSEHAILQPKGLRAFIPANSPTCMRTWVSEANRLRKLLPEGVHETLLKHETAGTYQDPEYLAASRVFYDHHVCRVIPWPEEVARTFAAVDADPTVYHAMSGPTEFHVIGSLKDWKSTGRLSAINVPTLVISGRHDEATPLVVKPFLDEIADVRWALFEDSSHMPHVEERQACMGTVVKFLDEVCSAKYKVLKAS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD101 sgRNA CRISPR Lentivector (Human) (Target 2)
K2756003 1.0 µg DNA

CD101 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CSNK1E Protein Vector (Mouse) (pPM-C-HA)
PV168428 500 ng

CSNK1E Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
[4- (Methoxymethyl) oxan-4-yl]methanamine hydrochloride
KFC69674-01 50 mg

[4- (Methoxymethyl) oxan-4-yl]methanamine hydrochloride

Sign In for Pricing
View Details
[4- (Methoxymethyl) oxan-4-yl]methanamine hydrochloride
KFC69674-02 0.5 g

[4- (Methoxymethyl) oxan-4-yl]methanamine hydrochloride

Sign In for Pricing
View Details
ZNF615 Double Nickase Plasmid (h2)
sc-415377-NIC-2 20 µg

ZNF615 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
ATP5F1A Peptide - middle region
orb2000932 100 µg

ATP5F1A Peptide - middle region

Sign In for Pricing
View Details