Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFI6 protein

This Human IFI6 protein spans the amino acid sequence from region 24-130aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon-induced protein 6-16

UniProt

P09912

Expression Region

24-130aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-B2M-tagged: N-terminal 6xHis-B2M-tagged34-189AA: 24-130AAPartial : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RANBP3L Antibody
NBP2-38929-25ul 25 µL

Rabbit Polyclonal RANBP3L Antibody

Sign In for Pricing
View Details
Oncostatin M (OSM) Magnetic Luminex Assay Kit
LKU604905 96 Tests

Oncostatin M (OSM) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Hs3st3a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3418606 1.0 µg DNA

Hs3st3a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Lentiviral human ANGPTL5 shRNA (UAS) - Lentiviral human ANGPTL5 shRNA (UAS) (25)
GTR15084869 1 Vial

Lentiviral human ANGPTL5 shRNA (UAS) - Lentiviral human ANGPTL5 shRNA (UAS) (25)

Sign In for Pricing
View Details
Gpbar1 (NM_177936) Rat Untagged Clone
RN210451 10 µg

Gpbar1 (NM_177936) Rat Untagged Clone

Sign In for Pricing
View Details
Rabbit Polyclonal CHD1 Antibody [mFluor Violet 500 SE]
NBP2-98902MFV500 0.1 mL

Rabbit Polyclonal CHD1 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details