Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial caf1 protein

This Bacterial caf1 protein spans the amino acid sequence from region 22-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Caf1, YPMT1.84, Y1100, YP_pMT082F1 capsule antigen

UniProt

P26948

Expression Region

22-170aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Yersinia pestis

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 10xHis-tagged: N-terminal 6xHis-tagged185-366AA: 22-170AAPartial: Full length of mature protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PTP1B protein
orb1292409-01 50 µg

Human PTP1B protein

Sign In for Pricing
View Details
Human PTP1B protein
orb1292409-02 100 µg

Human PTP1B protein

Sign In for Pricing
View Details
Human PTP1B protein
orb1292409-03 200 µg

Human PTP1B protein

Sign In for Pricing
View Details
Human PTP1B protein
orb1292409-04 1 mg

Human PTP1B protein

Sign In for Pricing
View Details
PCYT1B (NM_001163265) Human Tagged ORF Clone Lentiviral Particle
RC228261L3V 200 µL

PCYT1B (NM_001163265) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mysm1-set siRNA/shRNA/RNAi Lentivector (Mouse)
31339094 4x 500 ng

Mysm1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details